Polyclonal Rabbit anti-Human UCN2 / SRP Antibody (IHC, IF, WB) LS-C335681

Catalog Number: LS-C335681-20
Article Name: Polyclonal Rabbit anti-Human UCN2 / SRP Antibody (IHC, IF, WB) LS-C335681
Biozol Catalog Number: LS-C335681-20
Supplier Catalog Number: LS-C335681-20
Alternative Catalog Number: LS-C335681-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1). VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
Conjugation: Unconjugated
Alternative Names: UCN2, SRP, Ucn II, UCN-II, UCNI, Urocortin 2, UR, Urocortin-related peptide, Stresscopin-related peptide, Urocortin II, Urocortin-2, URP
SRP antibody LS-C335681 is an unconjugated rabbit polyclonal antibody to SRP (UCN2) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 90226
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:100), IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 12kDa, while the observed MW by Western blot was 12kDa.
Western blot analysis of extracts of rat skin cells.
Immunohistochemistry of paraffin-embedded mouse heart.
Immunofluorescence analysis of U2OS cells.