Polyclonal Rabbit anti-Human SLC17A7 / VGLUT1 Antibody (WB) LS-C747949

Catalog Number: LS-C747949-100
Article Name: Polyclonal Rabbit anti-Human SLC17A7 / VGLUT1 Antibody (WB) LS-C747949
Biozol Catalog Number: LS-C747949-100
Supplier Catalog Number: LS-C747949-100
Alternative Catalog Number: LS-C747949-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP_064705.1). KHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY
Conjugation: Unconjugated
Alternative Names: SLC17A7, BNPI, VGLUT1
VGLUT1 antibody LS-C747949 is an unconjugated rabbit polyclonal antibody to VGLUT1 (SLC17A7) from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 57030
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:200 - 1:2000)
Application Notes: The predicted MW is 53kDa/59kDa/61kDa, while the observed MW by Western blot was 50kDa.