Polyclonal Rabbit anti-Human ST6GALNAC4 Antibody (WB) LS-C747950

Catalog Number: LS-C747950-20
Article Name: Polyclonal Rabbit anti-Human ST6GALNAC4 Antibody (WB) LS-C747950
Biozol Catalog Number: LS-C747950-20
Supplier Catalog Number: LS-C747950-20
Alternative Catalog Number: LS-C747950-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1). TLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSF
Conjugation: Unconjugated
Alternative Names: ST6GALNAC4, Sialyltransferase 3C, Sialyltransferase 7D, SIAT3-C, SIAT7-D, SIAT3C, ST6GalNAc IV, ST6GALNACIV, SIAT7D
ST6GALNAC4 antibody LS-C747950 is an unconjugated rabbit polyclonal antibody to ST6GALNAC4 from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 27090
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:1000 - 1:2000)
Application Notes: The predicted MW is 34kDa, while the observed MW by Western blot was 34kDa.