Polyclonal Rabbit anti-Human TDRD1 Antibody (WB) LS-C747953

Catalog Number: LS-C747953-100
Article Name: Polyclonal Rabbit anti-Human TDRD1 Antibody (WB) LS-C747953
Biozol Catalog Number: LS-C747953-100
Supplier Catalog Number: LS-C747953-100
Alternative Catalog Number: LS-C747953-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human TDRD1 (NP_942090.1). PFNFEKNENKLPPHESLRSPGTLPNHPNFRLKSSENGNKKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVGSKGDRKKLPAGNSVSPPSAESNSPPKE
Conjugation: Unconjugated
Alternative Names: TDRD1, Cancer/testis antigen 41.1, CT41.1, Tudor domain containing 1
TDRD1 antibody LS-C747953 is an unconjugated rabbit polyclonal antibody to TDRD1 from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 56165
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:1000 - 1:2000)
Application Notes: The predicted MW is 79kDa/119kDa/132kDa, while the observed MW by Western blot was 130kDa.