Polyclonal Rabbit anti-Human GPR55 Antibody (WB) LS-C747960

Catalog Number: LS-C747960-20
Article Name: Polyclonal Rabbit anti-Human GPR55 Antibody (WB) LS-C747960
Biozol Catalog Number: LS-C747960-20
Supplier Catalog Number: LS-C747960-20
Alternative Catalog Number: LS-C747960-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-319 of human GPR55 (NP_005674.2). GRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
Conjugation: Unconjugated
Alternative Names: GPR55, G-protein coupled receptor 55, G protein-coupled receptor 55
GPR55 antibody LS-C747960 is an unconjugated rabbit polyclonal antibody to GPR55 from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 9290
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 36kDa, while the observed MW by Western blot was 40kDa.
494,00 €
20 µl
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL