Polyclonal Rabbit anti-Human SDS Antibody (WB) LS-C747968

Catalog Number: LS-C747968-20
Article Name: Polyclonal Rabbit anti-Human SDS Antibody (WB) LS-C747968
Biozol Catalog Number: LS-C747968-20
Supplier Catalog Number: LS-C747968-20
Alternative Catalog Number: LS-C747968-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human SDS (NP_006834.2). TTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGG
Conjugation: Unconjugated
Alternative Names: SDS, L-serine ammonia-lyase, L-serine dehydratase, Serine dehydratase, SDH, TDH, L-serine deaminase, L-threonine dehydratase
SDS antibody LS-C747968 is an unconjugated rabbit polyclonal antibody to SDS from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 10993
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 34kDa, while the observed MW by Western blot was 35kDa.