Recombinant fusion protein containing a sequence corresponding to amino acids 93-154 of human AKT3 (NP_859029.1). EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
Conjugation:
Unconjugated
Alternative Names:
AKT3, AKT3/PKBgamma, PRKBG, PKB gamma, Protein kinase Akt-3, RAC-gamma, MPPH, PKB-GAMMA, PKBG, Protein kinase B gamma, RAC-PK-gamma, STK-2
AKT3 antibody LS-C747979 is an unconjugated rabbit polyclonal antibody to AKT3 from human. It is reactive with human, mouse and rat. Validated for WB.