Polyclonal Rabbit anti-Human CLU / Clusterin Antibody (WB) LS-C747981

Catalog Number: LS-C747981-20
Article Name: Polyclonal Rabbit anti-Human CLU / Clusterin Antibody (WB) LS-C747981
Biozol Catalog Number: LS-C747981-20
Supplier Catalog Number: LS-C747981-20
Alternative Catalog Number: LS-C747981-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human CLU (NP_001822.3). DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
Conjugation: Unconjugated
Alternative Names: CLU, APO-J, Apolipoprotein J, CLU1, Clusterin, Complement lysis inhibitor, CLI, AAG4, Aging-associated protein 4, Ku70-binding protein 1, KUB1, SGP2, APOJ, SGP-2, Sulfated glycoprotein 2, CLU2, Complement cytolysis inhibitor, NA1/NA2, SP-40
Clusterin antibody LS-C747981 is an unconjugated rabbit polyclonal antibody to Clusterin (CLU) from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 1191
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 32kDa/48kDa/52kDa/53kDa/57kDa, while the observed MW by Western blot was 35kDa.
494,00 €
20 µl
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL