Polyclonal Rabbit anti-Human CLDN4 / Claudin 4 Antibody (WB) LS-C747983

Catalog Number: LS-C747983-20
Article Name: Polyclonal Rabbit anti-Human CLDN4 / Claudin 4 Antibody (WB) LS-C747983
Biozol Catalog Number: LS-C747983-20
Supplier Catalog Number: LS-C747983-20
Alternative Catalog Number: LS-C747983-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human CLDN4 (NP_001296.1). VGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Conjugation: Unconjugated
Alternative Names: CLDN4, Claudin-4, CPE-receptor, CPETR, CPETR1, Claudin 4, CPE-R, HCPE-R, WBSCR8, CPER
Claudin 4 antibody LS-C747983 is an unconjugated rabbit polyclonal antibody to human Claudin 4 (CLDN4). Validated for WB.
Clonality: Polyclonal
NCBI: 1364
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:1000)
Application Notes: The predicted MW is 22kDa, while the observed MW by Western blot was 22kDa.