Polyclonal Rabbit anti-Human P2RX3 / P2X3 Antibody (WB) LS-C747997

Catalog Number: LS-C747997-20
Article Name: Polyclonal Rabbit anti-Human P2RX3 / P2X3 Antibody (WB) LS-C747997
Biozol Catalog Number: LS-C747997-20
Supplier Catalog Number: LS-C747997-20
Alternative Catalog Number: LS-C747997-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 328-397 of human P2RX3 (NP_002550.2). AFTSVGVGTVLCDIILLNFLKGADQYKAKKFEEVNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
Conjugation: Unconjugated
Alternative Names: P2RX3, ATP receptor, p2X3, p2X3 purinoceptor, p2X purinoceptor 3, Purinergic receptor P2X3, Purinoceptor P2X3, Purinergic receptor, p2RX3, p2X receptor 3, p2X receptor, subunit 3
P2X3 antibody LS-C747997 is an unconjugated rabbit polyclonal antibody to P2X3 (P2RX3) from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 5024
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:1000)
Application Notes: The predicted MW is 44kDa, while the observed MW by Western blot was 44kDa.
494,00 €
20 µl
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL