Polyclonal Rabbit anti-Human ENOX1 / CNOX Antibody (WB) LS-C749286

Catalog Number: LS-C749286-20
Article Name: Polyclonal Rabbit anti-Human ENOX1 / CNOX Antibody (WB) LS-C749286
Biozol Catalog Number: LS-C749286-20
Supplier Catalog Number: LS-C749286-20
Alternative Catalog Number: LS-C749286-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 450-560 of human ENOX1 (NP_060463.2). LKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ
Conjugation: Unconjugated
Alternative Names: ENOX1, CCNOX, CNOX, PIG38, BA64J21.1, Constitutive Ecto-NOX
CNOX antibody LS-C749286 is an unconjugated rabbit polyclonal antibody to CNOX (ENOX1) from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 55068
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 27kDa/73kDa, while the observed MW by Western blot was 73kDa.