Polyclonal Rabbit anti-Human BAFF Receptor / CD268 Antibody (WB) LS-C749304

Catalog Number: LS-C749304-100
Article Name: Polyclonal Rabbit anti-Human BAFF Receptor / CD268 Antibody (WB) LS-C749304
Biozol Catalog Number: LS-C749304-100
Supplier Catalog Number: LS-C749304-100
Alternative Catalog Number: LS-C749304-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TNFRSF13C (NP_443177.1). MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFG
Conjugation: Unconjugated
Alternative Names: TNFRSF13C, BAFFR, BR3, BAFF receptor, BLyS receptor 3, CD268, CD268 antigen, CVID4, BAFF-R, BROMIX
CD268 antibody LS-C749304 is an unconjugated rabbit polyclonal antibody to CD268 (BAFF Receptor) from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 115650
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 18kDa, while the observed MW by Western blot was 19kDa.