Polyclonal Rabbit anti-Human RAB12 Antibody (WB) LS-C749323

Catalog Number: LS-C749323-20
Article Name: Polyclonal Rabbit anti-Human RAB12 Antibody (WB) LS-C749323
Biozol Catalog Number: LS-C749323-20
Supplier Catalog Number: LS-C749323-20
Alternative Catalog Number: LS-C749323-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RAB12 (NP_001020471.2). MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA
Conjugation: Unconjugated
Alternative Names: RAB12, Ras-related protein Rab-12
RAB12 antibody LS-C749323 is an unconjugated rabbit polyclonal antibody to RAB12 from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 201475
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 27kDa, while the observed MW by Western blot was 36kDa.