TGFBR1 Antibody, Rabbit, Polyclonal

Catalog Number: NSJ-R32084
Article Name: TGFBR1 Antibody, Rabbit, Polyclonal
Biozol Catalog Number: NSJ-R32084
Supplier Catalog Number: R32084
Alternative Catalog Number: NSJ-R32084
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Amino acids HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT of human TGFBR1 were used as the immunogen for the TGFBR1 antibody.
Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons. The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.
Clonality: Polyclonal
UniProt: P36897
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Purity: Antigen affinity
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Dilute: Western blot: 0.1-0.5ug/ml
Application Notes: Optimal dilution of the TGFBR1 antibody should be determined by the researcher.