PAR2 Antibody / F2RL1, Rabbit, Polyclonal

Catalog Number: NSJ-R32144
Article Name: PAR2 Antibody / F2RL1, Rabbit, Polyclonal
Biozol Catalog Number: NSJ-R32144
Supplier Catalog Number: R32144
Alternative Catalog Number: NSJ-R32144
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.
Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
Clonality: Polyclonal
UniProt: P55085
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity: Antigen affinity
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Dilute: Western blot: 0.1-0.5ug/ml
Application Notes: Optimal dilution of the PAR2 antibody should be determined by the researcher.