Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.
Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. Whats more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogrens syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
