PTP4A2 Antibody, Rabbit, Polyclonal

Catalog Number: NSJ-R32207
Article Name: PTP4A2 Antibody, Rabbit, Polyclonal
Biozol Catalog Number: NSJ-R32207
Supplier Catalog Number: R32207
Alternative Catalog Number: NSJ-R32207
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: FACS, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.
Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
Clonality: Polyclonal
UniProt: Q12974
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity: Antigen affinity
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Dilute: Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/10 6 cells
Application Notes: Optimal dilution of the PTP4A2 antibody should be determined by the researcher.