APTX (Forkhead-associated Domain Histidine Triad-like Protein, FHA-HIT, Aprataxin, AXA1, FLJ20157, MGC1072) (Biotin), IgG2a, Clone: [2H6], Mouse, Monoclonal

Catalog Number: USB-123456-BIOTIN
Article Name: APTX (Forkhead-associated Domain Histidine Triad-like Protein, FHA-HIT, Aprataxin, AXA1, FLJ20157, MGC1072) (Biotin), IgG2a, Clone: [2H6], Mouse, Monoclonal
Biozol Catalog Number: USB-123456-BIOTIN
Supplier Catalog Number: 123456-Biotin
Alternative Catalog Number: USB-123456-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa69-167 from human APTX (NP_778241) with GST tag. MW of the GST tag alone is 26kD.
APTX is encoding a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHW Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2H6]
Isotype: IgG2a
NCBI: 175071
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.