NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248), Rabbit

Catalog Number: USB-123463
Article Name: NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248), Rabbit
Biozol Catalog Number: USB-123463
Supplier Catalog Number: 123463
Alternative Catalog Number: USB-123463-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human ARD1A, aa1-235 (NP_003482.1).
In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 003491
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.