ARF5 (ADP-ribosylation Factor 5) (HRP), Clone: [1B4], Mouse, Monoclonal
Catalog Number:
USB-123464-HRP
- Images (0)
| Article Name: | ARF5 (ADP-ribosylation Factor 5) (HRP), Clone: [1B4], Mouse, Monoclonal |
| Biozol Catalog Number: | USB-123464-HRP |
| Supplier Catalog Number: | 123464-HRP |
| Alternative Catalog Number: | USB-123464-HRP-100 |
| Manufacturer: | US Biological |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Immunogen: | Partial recombinant corresponding to aa81-180 from human ARF5 (AAH03043) with GST tag. MW of the GST tag alone is 26kD. |
| GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody. |
Product Guarantee and Expert Support
