PCGF3 (Ring Finger Protein 3, RNF3, RING Finger Protein 3A, RNF3A, DONG1, Polycomb Group Ring Finger Protein 3) (MaxLight 650), Clone: [1F1], Mouse, Monoclonal
PCGF3 (Ring Finger Protein 3, RNF3, RING Finger Protein 3A, RNF3A, DONG1, Polycomb Group Ring Finger Protein 3) (MaxLight 650), Clone: [1F1], Mouse, Monoclonal
PCGF3 (Ring Finger Protein 3, RNF3, RING Finger Protein 3A, RNF3A, DONG1, Polycomb Group Ring Finger Protein 3) (MaxLight 650), Clone: [1F1], Mouse, Monoclonal
Biozol Catalog Number:
USB-130988-ML650
Supplier Catalog Number:
130988-ML650
Alternative Catalog Number:
USB-130988-ML650-100
Manufacturer:
US Biological
Host:
Mouse
Category:
Antikörper
Application:
FLISA, IHC
Immunogen:
Partial recombinant corresponding to aa133-242 from PCGF3 (NP_006306) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A Lys-119, rendering chromatin heritably changed in its expressibility. Applications: Suitable for use in FLISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.