PCGF5 (Polycomb Group RING Finger Protein 5, RING Finger Protein 159, RNF159, MGC16202), Clone: [3C10], Mouse, Monoclonal

Catalog Number: USB-130989
Article Name: PCGF5 (Polycomb Group RING Finger Protein 5, RING Finger Protein 159, RNF159, MGC16202), Clone: [3C10], Mouse, Monoclonal
Biozol Catalog Number: USB-130989
Supplier Catalog Number: 130989
Alternative Catalog Number: USB-130989-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa51-149 from human PCGF5 (NP_115749) with GST tag. MW of the GST tag alone is 26kD.
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A Lys-119, rendering chromatin heritably changed in its expressibility. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIAICLDCLRN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3C10]
NCBI: 032373
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.