PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (Biotin), Clone: [2B8], Mouse, Monoclonal

Catalog Number: USB-130991-BIOTIN
Article Name: PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (Biotin), Clone: [2B8], Mouse, Monoclonal
Biozol Catalog Number: USB-130991-BIOTIN
Supplier Catalog Number: 130991-Biotin
Alternative Catalog Number: USB-130991-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA
Immunogen: Partial recombinant corresponding to aa225-325 from human PCGF6 (NP_001011663) with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRR Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2B8]
NCBI: 001011663
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.