WWP2 (WW Domain-containing Protein 2 Atrophin-1-interacting Protein 2, AIP2, NEDD4-like E3 Ubiquitin-protein Ligase WWP2, WWp2-like), Mouse

Catalog Number: USB-135421
Article Name: WWP2 (WW Domain-containing Protein 2 Atrophin-1-interacting Protein 2, AIP2, NEDD4-like E3 Ubiquitin-protein Ligase WWP2, WWp2-like), Mouse
Biozol Catalog Number: USB-135421
Supplier Catalog Number: 135421
Alternative Catalog Number: USB-135421-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human WWP2, aa1-335 (NP_955455.1).
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 199423
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.