Anti-Interferon alpha 2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A58353-5
Artikelname: Anti-Interferon alpha 2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A58353-5
Hersteller Artikelnummer: A58353-5
Alternativnummer: ABC-A58353-5
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Human Interferon a 2a expressed in plants.
Konjugation: Unconjugated
Rabbit polyclonal antibody to Interferon alpha 2.
Klonalität: Polyclonal
Konzentration: Reconstitution dependent.
Puffer: Lyophilized from Phosphate Buffered Saline, pH 7.4.
Reinheit: >98% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Target-Kategorie: Interferon alpha 2
Antibody Type: Primary Antibody
Application Verdünnung: ELISA: at least 1/500, allows the detection of 0.2-1 ng/well of human Interferon a 2a, WB: 1/1,000.