Anti-Interferon alpha 2 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A58353-5
| Article Name: |
Anti-Interferon alpha 2 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A58353-5 |
| Supplier Catalog Number: |
A58353-5 |
| Alternative Catalog Number: |
ABC-A58353-5 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Human Interferon a 2a expressed in plants. |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Interferon alpha 2. |
| Clonality: |
Polyclonal |
| Concentration: |
Reconstitution dependent. |
| Buffer: |
Lyophilized from Phosphate Buffered Saline, pH 7.4. |
| Purity: |
>98% as determined by SDS-PAGE. |
| Form: |
Lyophilized |
| Sequence: |
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Target: |
Interferon alpha 2 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
ELISA: at least 1/500, allows the detection of 0.2-1 ng/well of human Interferon a 2a, WB: 1/1,000. |