Anti-NF-kB p65 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A81024-100
Artikelname: Anti-NF-kB p65 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A81024-100
Hersteller Artikelnummer: A81024-100
Alternativnummer: ABC-A81024-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NF-kB p65/RelA (NP_068810.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NF-kB p65.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 65 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: YEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN
Target-Kategorie: NF-kB p65
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000