Anti-NF-kB p65 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A81024-100
Article Name: Anti-NF-kB p65 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A81024-100
Supplier Catalog Number: A81024-100
Alternative Catalog Number: ABC-A81024-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NF-kB p65/RelA (NP_068810.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NF-kB p65.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 65 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: YEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN
Target: NF-kB p65
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000