Anti-Liver Carboxylesterase 1/CES1 Antibody [ARC0613], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81049-100
Artikelname: Anti-Liver Carboxylesterase 1/CES1 Antibody [ARC0613], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81049-100
Hersteller Artikelnummer: A81049-100
Alternativnummer: ABC-A81049-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CES1 (P23141).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0613] antibody to Liver Carboxylesterase 1/CES1.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0613]
Molekulargewicht: 63 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
Target-Kategorie: Liver Carboxylesterase 1/CES1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200