Anti-Liver Carboxylesterase 1/CES1 Antibody [ARC0613], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A81049-100
| Article Name: |
Anti-Liver Carboxylesterase 1/CES1 Antibody [ARC0613], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A81049-100 |
| Supplier Catalog Number: |
A81049-100 |
| Alternative Catalog Number: |
ABC-A81049-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CES1 (P23141). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0613] antibody to Liver Carboxylesterase 1/CES1. |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC0613] |
| Molecular Weight: |
63 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL |
| Target: |
Liver Carboxylesterase 1/CES1 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2,000, ICC/IF: 1:50-1:200 |
