Anti-Rad50 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88557-100
Artikelname: Anti-Rad50 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88557-100
Hersteller Artikelnummer: A88557-100
Alternativnummer: ABC-A88557-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Rad50 (Q92878).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Rad50.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 180 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: TDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLV
Target-Kategorie: Rad50
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:100