Anti-Rad50 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88557-100
Article Name: Anti-Rad50 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88557-100
Supplier Catalog Number: A88557-100
Alternative Catalog Number: ABC-A88557-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Rad50 (Q92878).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Rad50.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 180 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: TDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLV
Target: Rad50
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:100