Anti-Ribonuclease 3/ECP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88579-100
Artikelname: Anti-Ribonuclease 3/ECP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88579-100
Hersteller Artikelnummer: A88579-100
Alternativnummer: ABC-A88579-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RNASE3 (NP_002926.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Ribonuclease 3/ECP.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: FLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYP
Target-Kategorie: Ribonuclease 3/ECP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000