Anti-Ribonuclease 3/ECP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88579-100
Article Name: Anti-Ribonuclease 3/ECP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88579-100
Supplier Catalog Number: A88579-100
Alternative Catalog Number: ABC-A88579-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RNASE3 (NP_002926.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Ribonuclease 3/ECP.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 16 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: FLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYP
Target: Ribonuclease 3/ECP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000