Anti-Glutamyl Prolyl tRNA synthetase/PARS Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88615-100
Artikelname: Anti-Glutamyl Prolyl tRNA synthetase/PARS Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88615-100
Hersteller Artikelnummer: A88615-100
Alternativnummer: ABC-A88615-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Glutamyl Prolyl tRNA synthetase/PARS.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 190 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS
Target-Kategorie: Glutamyl Prolyl tRNA synthetase/PARS
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:100