Anti-Glutamyl Prolyl tRNA synthetase/PARS Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88615-100
Article Name: Anti-Glutamyl Prolyl tRNA synthetase/PARS Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88615-100
Supplier Catalog Number: A88615-100
Alternative Catalog Number: ABC-A88615-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Glutamyl Prolyl tRNA synthetase/PARS.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 190 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS
Target: Glutamyl Prolyl tRNA synthetase/PARS
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:100