Anti-CNBP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88625-100
Artikelname: Anti-CNBP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88625-100
Hersteller Artikelnummer: A88625-100
Alternativnummer: ABC-A88625-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CNBP (NP_001120668.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CNBP.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 20 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
Target-Kategorie: CNBP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200