Anti-CNBP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88625-100
Article Name: Anti-CNBP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88625-100
Supplier Catalog Number: A88625-100
Alternative Catalog Number: ABC-A88625-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CNBP (NP_001120668.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CNBP.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 20 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
Target: CNBP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200