Anti-TEF1/TEAD-1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90118-100
Artikelname: Anti-TEF1/TEAD-1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90118-100
Hersteller Artikelnummer: A90118-100
Alternativnummer: ABC-A90118-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEAD1 (NP_068780.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TEF1/TEAD-1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
Target-Kategorie: TEF1/TEAD-1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, ChIP: 1:20-1:50