Anti-TEF1/TEAD-1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90118-100
Article Name: Anti-TEF1/TEAD-1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90118-100
Supplier Catalog Number: A90118-100
Alternative Catalog Number: ABC-A90118-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEAD1 (NP_068780.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TEF1/TEAD-1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 50 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
Target: TEF1/TEAD-1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, ChIP: 1:20-1:50