Psca (Mouse) Recombinant Protein, E. coli
Artikelnummer:
ABN-P10553
| Artikelname: |
Psca (Mouse) Recombinant Protein, E. coli |
| Artikelnummer: |
ABN-P10553 |
| Hersteller Artikelnummer: |
P10553 |
| Alternativnummer: |
ABN-P10553-100 |
| Hersteller: |
Abnova |
| Wirt: |
E. coli |
| Kategorie: |
Proteine/Peptide |
| Applikation: |
SDS-PAGE |
| Spezies Reaktivität: |
Mouse |
| Mouse Psca partial recombinant protein with His tag expressed in Escherichia coli. |
| Tag: |
His (C-term) |
| UniProt: |
72373 |
| Puffer: |
Lyophilized from a 0.2 um filtered solution of 50 mM Tris, 150 mM NaCl, 0.01% sarkosyl, pH 8.0 |
| Reinheit: |
>=90% as determined by SDS-PAGE. |
| Formulierung: |
Lyophilized |
| Sequenz: |
MKTVFFLLLATYLALHPGAALQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN |
| Target-Kategorie: |
Psca |
| Application Verdünnung: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |