Psca (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P10553
| Article Name: |
Psca (Mouse) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P10553 |
| Supplier Catalog Number: |
P10553 |
| Alternative Catalog Number: |
ABN-P10553-100 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Mouse |
| Mouse Psca partial recombinant protein with His tag expressed in Escherichia coli. |
| Tag: |
His (C-term) |
| UniProt: |
72373 |
| Buffer: |
Lyophilized from a 0.2 um filtered solution of 50 mM Tris, 150 mM NaCl, 0.01% sarkosyl, pH 8.0 |
| Purity: |
>=90% as determined by SDS-PAGE. |
| Form: |
Lyophilized |
| Sequence: |
MKTVFFLLLATYLALHPGAALQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN |
| Target: |
Psca |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
