Nr3c1 (Mouse) Recombinant Protein, E. coli
Artikelnummer:
ABN-P10554
| Artikelname: |
Nr3c1 (Mouse) Recombinant Protein, E. coli |
| Artikelnummer: |
ABN-P10554 |
| Hersteller Artikelnummer: |
P10554 |
| Alternativnummer: |
ABN-P10554-100 |
| Hersteller: |
Abnova |
| Wirt: |
E. coli |
| Kategorie: |
Proteine/Peptide |
| Applikation: |
SDS-PAGE |
| Spezies Reaktivität: |
Mouse |
| Mouse Nr3c1 partial recombinant protein with His tag expressed in Escherichia coli. |
| Tag: |
His (N-term) |
| UniProt: |
14815 |
| Puffer: |
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4 |
| Reinheit: |
>=85% as determined by SDS-PAGE. |
| Formulierung: |
Lyophilized |
| Sequenz: |
VPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSNGNIKKLLFH |
| Target-Kategorie: |
Nr3c1 |
| Application Verdünnung: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
