Nr3c1 (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P10554
Article Name: Nr3c1 (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P10554
Supplier Catalog Number: P10554
Alternative Catalog Number: ABN-P10554-100
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Mouse
Mouse Nr3c1 partial recombinant protein with His tag expressed in Escherichia coli.
Tag: His (N-term)
UniProt: 14815
Buffer: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4
Purity: >=85% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: VPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSNGNIKKLLFH
Target: Nr3c1
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.