TNFRSF8 (Human) Recombinant Protein

Artikelnummer: ABN-P10563
Artikelname: TNFRSF8 (Human) Recombinant Protein
Artikelnummer: ABN-P10563
Hersteller Artikelnummer: P10563
Alternativnummer: ABN-P10563-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human TNFRSF8 partial recombinant protein with His tag at the C-terminus expressed in HEK293 cells.
Tag: His (C-term)
UniProt: 943
Puffer: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Reinheit: >=95% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGR
Target-Kategorie: TNFRSF8
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.