TNFRSF8 (Human) Recombinant Protein

Catalog Number: ABN-P10563
Article Name: TNFRSF8 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P10563
Supplier Catalog Number: P10563
Alternative Catalog Number: ABN-P10563-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human TNFRSF8 partial recombinant protein with His tag at the C-terminus expressed in HEK293 cells.
Tag: His (C-term)
UniProt: 943
Buffer: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Purity: >=95% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGR
Target: TNFRSF8
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.