IL4R (Human) Recombinant Protein

Artikelnummer: ABN-P10591
Artikelname: IL4R (Human) Recombinant Protein
Artikelnummer: ABN-P10591
Hersteller Artikelnummer: P10591
Alternativnummer: ABN-P10591-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human IL4R partial recombinant protein with His tag expressed in HEK293 cells.
Tag: His (C-term)
UniProt: 3566
Puffer: Lyophilized from filtered PBS, pH 7.4.
Reinheit: >=95% by SDS-PAGE
Formulierung: Lyophilized
Sequenz: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Target-Kategorie: IL4R
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.