IL4R (Human) Recombinant Protein
Catalog Number:
ABN-P10591
| Article Name: |
IL4R (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P10591 |
| Supplier Catalog Number: |
P10591 |
| Alternative Catalog Number: |
ABN-P10591-100 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human IL4R partial recombinant protein with His tag expressed in HEK293 cells. |
| Tag: |
His (C-term) |
| UniProt: |
3566 |
| Buffer: |
Lyophilized from filtered PBS, pH 7.4. |
| Purity: |
>=95% by SDS-PAGE |
| Form: |
Lyophilized |
| Sequence: |
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
| Target: |
IL4R |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
