H2-Q7 (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P10600
Artikelname: H2-Q7 (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P10600
Hersteller Artikelnummer: P10600
Alternativnummer: ABN-P10600-100
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse H2-Q7 partial recombinant protein with His tag expressed in CHO cells.
Tag: His (C-term)
UniProt: 15018
Puffer: Lyophilized from filtered PBS, pH 7.4.
Reinheit: >=95% by SDS-PAGE
Formulierung: Lyophilized
Sequenz: MALTMLLLLVAAALTLIETRAGQHSLQYFHTAVSRPGLGEPWFISVGYVDDTQFVRFDSDAENPRMEPRARWMEQEGPEYWERETQIAKGHEQSFRGSLRTAQSYYNQSKG
Target-Kategorie: H2-Q7
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.