H2-Q7 (Mouse) Recombinant Protein, Mammal

Catalog Number: ABN-P10600
Article Name: H2-Q7 (Mouse) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P10600
Supplier Catalog Number: P10600
Alternative Catalog Number: ABN-P10600-100
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Mouse
Mouse H2-Q7 partial recombinant protein with His tag expressed in CHO cells.
Tag: His (C-term)
UniProt: 15018
Buffer: Lyophilized from filtered PBS, pH 7.4.
Purity: >=95% by SDS-PAGE
Form: Lyophilized
Sequence: MALTMLLLLVAAALTLIETRAGQHSLQYFHTAVSRPGLGEPWFISVGYVDDTQFVRFDSDAENPRMEPRARWMEQEGPEYWERETQIAKGHEQSFRGSLRTAQSYYNQSKG
Target: H2-Q7
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.